Paralogue Annotation for RYR2 residue 879

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 879
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 879

No paralogue variants have been mapped to residue 879 for RYR2.



RYR2DLLGPTVSLTQAAFTPIPVDTSQIVLPPHL>E<RIREKLAENIHELWVMNKIELGWQYGPVRD909
RYR1HLVGPSRCLSHTDFVPCPVDTVQIVLPPHL>E<RIREKLAENIHELWALTRIEQGWTYGPVRD897
RYR3DLLGTTQFLSQASFIPCPVDTSQVILPPHL>E<KIRDRLAENIHELWGMNKIELGWTFGKIRD896
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E879Qc.2635G>C Putative BenignSIFT: tolerated
Polyphen: probably damaging