Paralogue Annotation for RYR2 residue 953

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 953
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 953

No paralogue variants have been mapped to residue 953 for RYR2.



RYR2KLPEQERNYNLQMSLETLKTLLALGCHVGI>S<DEHAEDKVKKMKLPKNYQLTSGYKPAPMDL983
RYR1SLPEPERNYNLQMSGETLKTLLALGCHVGM>A<DEKAEDNLKKTKLPKTYMMSNGYKPAPLDL971
RYR3KLPETEKNYNLQMSTETLKTLLALGCHIAH>V<NPAAEEDLKKVKLPKNYMMSNGYKPAPLDL970
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S953Pc.2857T>C Putative BenignSIFT:
Polyphen: benign