Paralogue Annotation for SCN5A residue 1304

Residue details

Gene: SCN5A
Reference Sequences: LRG: LRG_289, Ensembl variant: ENST00000333535 / ENSP00000328968
Amino Acid Position: 1304
Reference Amino Acid: T - Threonine
Protein Domain: TM Domain 3


Paralogue Variants mapped to SCN5A residue 1304

No paralogue variants have been mapped to residue 1304 for SCN5A.



SCN5AVDVSLVSLVAN-T----LGFAEMGPIKSLR>T<LRALRPLRALSRFEGMRVVVNALVGAIPSI1334
SCN1AVDVSLVSLTAN-A----LGYSELGAIKSLR>T<LRALRPLRALSRFEGMRVVVNALLGAIPSI1347
SCN2AVDVSLVSLTAN-A----LGYSELGAIKSLR>T<LRALRPLRALSRFEGMRVVVNALLGAIPSI1337
SCN3AVDVSLVSLVAN-A----LGYSELGAIKSLR>T<LRALRPLRALSRFEGMRVVVNALVGAIPSI1335
SCN4AVDVSIISLVAN-W----LGYSELGPIKSLR>T<LRALRPLRALSRFEGMRVVVNALLGAIPSI1160
SCN7AVIVFCLSLIGK-T----RE--E---LKPLI>S<MKFLRPLRVLSQFERMKVVVRALIKTTLPT1058
SCN8AVAVSLVSLIAN-A----LGYSELGAIKSLR>T<LRALRPLRALSRFEGMRVVVNALVGAIPSI1327
SCN9AVDVSLVTLVAN-T----LGYSDLGPIKSLR>T<LRALRPLRALSRFEGMRVVVNALIGAIPSI1310
SCN10AVNISLISLTAK-I----LEYSEVAPIKALR>T<LRALRPLRALSRFEGMRVVVDALVGAIPSI1281
SCN11AVIVSVTTLI---------N---LMELKSFR>T<LRALRPLRALSQFEGMKVVVNALIGAIPAI1178
CACNA1AVSGALVAFAFTGN----SKGKDINTIKSLR>V<LRVLRPLKTIKRLPKLKAVFDCVVNSLKNV1377
CACNA1BVSGALVAFAFS-G----SKGKDINTIKSLR>V<LRVLRPLKTIKRLPKLKAVFDCVVNSLKNV1283
CACNA1CVSVSLISF----G----IQSSAINVVKILR>V<LRVLRPLRAINRAKGLKHVVQCVFVAIRTI1029
CACNA1DVGVSLVSF----G----IQSSAISVVKILR>V<LRVLRPLRAINRAKGLKHVVQCVFVAIRTI1035
CACNA1EVVGALVAFALANA-LGTNKGRDIKTIKSLR>V<LRVLRPLKTIKRLPKLKAVFDCVVTSLKNV1289
CACNA1FVSVSLISF----G----IHSSAISVVKILR>V<LRVLRPLRAINRAKGLKHVVQCVFVAIRTI1000
CACNA1GVLISVIDILVS-MVSD-SGTKILGMLRVLR>L<LRTLRPLRVISRAQGLKLVVETLMSSLKPI1412
CACNA1HVLVSLVDIVVA-MASA-GGAKILGVLRVLR>L<LRTLRPLRVISRAPGLKLVVETLISSLRPI1430
CACNA1IVFVSIIDIVVS-LASA-GGAKILGVLRVLR>L<LRTLRPLRVISRAPGLKLVVETLISSLKPI1306
CACNA1SVAVSLISM----G----LESSAISVVKILR>V<LRVLRPLRAINRAKGLKHVVQCMFVAISTI928
cons                              > <                              

See full Alignment of Paralogues


Known Variants in SCN5A

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1304Mc.3911C>T Inherited ArrhythmiaLQTS,BrSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Sodium channel abnormalities are infrequent in patients with long QT syndrome: identification of two novel SCN5A mutations. Am J Med Genet. 1999 86(5):470-6. 10508990
Inherited ArrhythmiaLQTS The elusive link between LQT3 and Brugada syndrome: the role of flecainide challenge. Circulation. 2000 102(9):945-7. 10961955
Inherited ArrhythmiaLQTS Prevalence of long-QT syndrome gene variants in sudden infant death syndrome. Circulation. 2007 115(3):361-7. 17210839
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Cardiac sodium channel dysfunction in sudden infant death syndrome. Circulation. 2007 115(3):368-76. 17210841
Inherited ArrhythmiaLQTS High prevalence of genetic variants previously associated with LQT syndrome in new exome data. Eur J Hum Genet. 2012 20(8):905-8. doi: 10.1038/ejhg.2012.23. 22378279
Inherited ArrhythmiaAF High prevalence of long QT syndrome-associated SCN5A variants in patients with early-onset lone atrial fibrillation. Circ Cardiovasc Genet. 2012 5(4):450-9. doi: 10.1161/CIRCGENETICS.111.962597. 22685113
Inherited ArrhythmiaLQTS Mutations in Genes Encoding Cardiac Ion Channels Previously Associated With Sudden Infant Death Syndrome (SIDS) Are Present With High Frequency in New Exome Data. Can J Cardiol. 2013 23465283
Inherited ArrhythmiaLQTS Actionable, pathogenic incidental findings in 1,000 participants' exomes. Am J Hum Genet. 2013 93(4):631-40. doi: 10.1016/j.ajhg.2013.08.006. 24055113
Inherited ArrhythmiaLQTS Loss-of-function of the voltage-gated sodium channel NaV1.5 (channelopathies) in patients with irritable bowel syndrome. Gastroenterology. 2014 146(7):1659-68. doi: 10.1053/j.gastro.2014.02.054. 24613995
Inherited ArrhythmiaBrS A pediatric case of Brugada syndrome diagnosed by fever-provoked ventricular tachycardia. Korean J Pediatr. 2014 57(8):374-8. doi: 10.3345/kjp.2014.57.8.374. 25210526
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
Unknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
Inherited ArrhythmiaLQTS Evaluation of ACMG-Guideline-Based Variant Classification of Cancer Susceptibility and Non-Cancer-Associated Genes in Families Affected by Breast Cancer. Am J Hum Genet. 2016 98(5):801-17. doi: 10.1016/j.ajhg.2016.02.024. 27153395