Paralogue Annotation for KCNE1 residue 32

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 32
Reference Amino Acid: R - Arginine
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE1 residue 32

No paralogue variants have been mapped to residue 32 for KCNE1.



KCNE1LTKLWQE---T------VQQGGN-MSGLA->R<RSPRSSDGKLEALYVLMVLGFFGFFTLGIM62
KCNE2FRRIFITYMDNW----RQNTTAEQEALQA->K<VDAENFY--YVILYLMVMIGMFSFIIVAIL68
KCNE3LKALNATLHSNLLCRPGPGLGPD-NQTEER>R<ASLPGR-DDNSYMYILFVMFLFAVTVGSLI76
KCNE4--MLKMEPLNST----HPGTAASSSPLES->R<AAGGGSGNGNEYFYILVVMSFYGIFLIGIM54
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R32Hc.95G>A Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: possibly damaging
ReportsInherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
p.R32Cc.94C>T Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Family-based cardiac screening in relatives of victims of sudden arrhythmic death syndrome. Europace. 2013 15(7):1050-8. doi: 10.1093/europace/eus408. 23382499