Paralogue Annotation for KCNE1 residue 39

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 39
Reference Amino Acid: D - Aspartate
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE1 residue 39

No paralogue variants have been mapped to residue 39 for KCNE1.



KCNE1---T------VQQGGN-MSGLA-RRSPRSS>D<GKLEALYVLMVLGFFGFFTLGIMLSYIRSK69
KCNE2YMDNW----RQNTTAEQEALQA-KVDAENF>Y<--YVILYLMVMIGMFSFIIVAILVSTVKSK75
KCNE3LHSNLLCRPGPGLGPD-NQTEERRASLPGR>-<DDNSYMYILFVMFLFAVTVGSLILGYTRSR83
KCNE4PLNST----HPGTAASSSPLES-RAAGGGS>G<NGNEYFYILVVMSFYGIFLIGIMLGYMKSK61
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D39Nc.115G>A Putative BenignSIFT: tolerated
Polyphen: benign
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953