Paralogue Annotation for KCNE1 residue 43

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 43
Reference Amino Acid: E - Glutamate
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE1 residue 43

No paralogue variants have been mapped to residue 43 for KCNE1.



KCNE1------VQQGGN-MSGLA-RRSPRSSDGKL>E<ALYVLMVLGFFGFFTLGIMLSYIRSKKLEH73
KCNE2W----RQNTTAEQEALQA-KVDAENFY--Y>V<ILYLMVMIGMFSFIIVAILVSTVKSKRREH79
KCNE3LLCRPGPGLGPD-NQTEERRASLPGR-DDN>S<YMYILFVMFLFAVTVGSLILGYTRSRKVDK87
KCNE4T----HPGTAASSSPLES-RAAGGGSGNGN>E<YFYILVVMSFYGIFLIGIMLGYMKSKRREK65
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E43N Putative BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953
p.E43Kc.127G>A Putative BenignSIFT:
Polyphen: