Paralogue Annotation for KCNE1 residue 49

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 49
Reference Amino Acid: M - Methionine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE1 residue 49

No paralogue variants have been mapped to residue 49 for KCNE1.



KCNE1VQQGGN-MSGLA-RRSPRSSDGKLEALYVL>M<VLGFFGFFTLGIMLSYIRSKKLEHSNDPFN79
KCNE2QNTTAEQEALQA-KVDAENFY--YVILYLM>V<MIGMFSFIIVAILVSTVKSKRREHSNDPYH85
KCNE3PGLGPD-NQTEERRASLPGR-DDNSYMYIL>F<VMFLFAVTVGSLILGYTRSRKVDKRSDPYH93
KCNE4PGTAASSSPLES-RAAGGGSGNGNEYFYIL>V<VMSFYGIFLIGIMLGYMKSKRREKKSSLLL71
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M49Ic.147G>A Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Results of genetic testing in 855 consecutive unrelated patients referred for long QT syndrome in a clinical laboratory. Genet Test Mol Biomarkers. 2013 17(7):553-61. doi: 10.1089/gtmb.2012.0118. 23631430