Paralogue Annotation for KCNE1 residue 54

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 54
Reference Amino Acid: F - Phenylalanine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE1 residue 54

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE2F60LLong QT syndromeHigh9 16922724

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE1.



KCNE1N-MSGLA-RRSPRSSDGKLEALYVLMVLGF>F<GFFTLGIMLSYIRSKKLEHSNDPFNVYIES84
KCNE2EQEALQA-KVDAENFY--YVILYLMVMIGM>F<SFIIVAILVSTVKSKRREHSNDPYHQYIVE90
KCNE3D-NQTEERRASLPGR-DDNSYMYILFVMFL>F<AVTVGSLILGYTRSRKVDKRSDPYHVYIKN98
KCNE4SSSPLES-RAAGGGSGNGNEYFYILVVMSF>Y<GIFLIGIMLGYMKSKRREKKSSLLLLYKDE76
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F54Vc.160T>G Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Postmortem molecular analysis of KCNQ1, KCNH2, KCNE1 and KCNE2 genes in sudden unexplained nocturnal death syndrome in the Chinese Han population. Forensic Sci Int. 2013 231(1-3):82-7. doi: 10.1016/j.forsciint.2013.04.02 23890619