Paralogue Annotation for KCNE1 residue 55

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 55
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE1 residue 55

No paralogue variants have been mapped to residue 55 for KCNE1.



KCNE1-MSGLA-RRSPRSSDGKLEALYVLMVLGFF>G<FFTLGIMLSYIRSKKLEHSNDPFNVYIESD85
KCNE2QEALQA-KVDAENFY--YVILYLMVMIGMF>S<FIIVAILVSTVKSKRREHSNDPYHQYIVED91
KCNE3-NQTEERRASLPGR-DDNSYMYILFVMFLF>A<VTVGSLILGYTRSRKVDKRSDPYHVYIKN-98
KCNE4SSPLES-RAAGGGSGNGNEYFYILVVMSFY>G<IFLIGIMLGYMKSKRREKKSSLLLLYKDEE77
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G55Sc.163G>A Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085