Paralogue Annotation for KCNE1 residue 59

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 59
Reference Amino Acid: L - Leucine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE1 residue 59

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE2V65MLong QT syndromeMedium9 12185453
KCNE2V65LLong QT syndromeMedium9 19716085

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE1.



KCNE1LA-RRSPRSSDGKLEALYVLMVLGFFGFFT>L<GIMLSYIRSKKLEHSNDPFNVYIESDA-WQ88
KCNE2QA-KVDAENFY--YVILYLMVMIGMFSFII>V<AILVSTVKSKRREHSNDPYHQYIVED--WQ93
KCNE3EERRASLPGR-DDNSYMYILFVMFLFAVTV>G<SLILGYTRSRKVDKRSDPYHVYIKN-----98
KCNE4ES-RAAGGGSGNGNEYFYILVVMSFYGIFL>I<GIMLGYMKSKRREKKSSLLLLYKDEERLWG81
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L59Pc.176T>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085