Paralogue Annotation for KCNE1 residue 67

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 67
Reference Amino Acid: R - Arginine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 67

No paralogue variants have been mapped to residue 67 for KCNE1.



KCNE1SSDGKLEALYVLMVLGFFGFFTLGIMLSYI>R<SKKLEHSNDPFNVYIESDA-WQEKDKAYVQ96
KCNE2NFY--YVILYLMVMIGMFSFIIVAILVSTV>K<SKRREHSNDPYHQYIVED--WQEKYKSQIL101
KCNE3GR-DDNSYMYILFVMFLFAVTVGSLILGYT>R<SRKVDKRSDPYHVYIKN-------------98
KCNE4GSGNGNEYFYILVVMSFYGIFLIGIMLGYM>K<SKRREKKSSLLLLYKDEERLWGEAMKPLPV89
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R67Cc.199C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
p.R67Hc.200G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
p.R67Sc.199C>A Putative BenignSIFT:
Polyphen: