Paralogue Annotation for KCNE1 residue 68

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 68
Reference Amino Acid: S - Serine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 68

No paralogue variants have been mapped to residue 68 for KCNE1.



KCNE1SDGKLEALYVLMVLGFFGFFTLGIMLSYIR>S<KKLEHSNDPFNVYIESDA-WQEKDKAYVQA97
KCNE2FY--YVILYLMVMIGMFSFIIVAILVSTVK>S<KRREHSNDPYHQYIVED--WQEKYKSQILN102
KCNE3R-DDNSYMYILFVMFLFAVTVGSLILGYTR>S<RKVDKRSDPYHVYIKN--------------98
KCNE4SGNGNEYFYILVVMSFYGIFLIGIMLGYMK>S<KRREKKSSLLLLYKDEERLWGEAMKPLPVV90
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S68T Putative BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953
p.S68Tc.202T>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging