Paralogue Annotation for KCNE1 residue 74

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 74
Reference Amino Acid: S - Serine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 74

No paralogue variants have been mapped to residue 74 for KCNE1.



KCNE1ALYVLMVLGFFGFFTLGIMLSYIRSKKLEH>S<NDPFNVYIESDA-WQEKDKAYVQARVLESY103
KCNE2ILYLMVMIGMFSFIIVAILVSTVKSKRREH>S<NDPYHQYIVED--WQEKYKSQILNL-----103
KCNE3YMYILFVMFLFAVTVGSLILGYTRSRKVDK>R<SDPYHVYIKN--------------------98
KCNE4YFYILVVMSFYGIFLIGIMLGYMKSKRREK>K<SSLLLLYKDEERLWGEAMKPLPVVSGLRSV96
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S74Ac.220T>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953
p.S74Lc.221C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Mutations in the hminK gene cause long QT syndrome and suppress IKs function. Nat Genet. 1997 17(3):338-40. 9354802
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Mechanisms of disease pathogenesis in long QT syndrome type 5. Am J Physiol Cell Physiol. 2010 298(2):C263-73. 19907016
p.S74Pc.220T>C Putative BenignSIFT:
Polyphen: