Paralogue Annotation for KCNE1 residue 79

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 79
Reference Amino Acid: N - Asparagine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 79

No paralogue variants have been mapped to residue 79 for KCNE1.



KCNE1MVLGFFGFFTLGIMLSYIRSKKLEHSNDPF>N<VYIESDA-WQEKDKAYVQARVLESYRSCYV108
KCNE2VMIGMFSFIIVAILVSTVKSKRREHSNDPY>H<QYIVED--WQEKYKSQILNL----------103
KCNE3FVMFLFAVTVGSLILGYTRSRKVDKRSDPY>H<VYIKN-------------------------98
KCNE4VVMSFYGIFLIGIMLGYMKSKRREKKSSLL>L<LYKDEERLWGEAMKPLPVVSGLRSVQVPLM101
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N79Dc.235A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953