Paralogue Annotation for KCNE1 residue 81

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 81
Reference Amino Acid: Y - Tyrosine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 81

No paralogue variants have been mapped to residue 81 for KCNE1.



KCNE1LGFFGFFTLGIMLSYIRSKKLEHSNDPFNV>Y<IESDA-WQEKDKAYVQARVLESYRSCYVV-109
KCNE2IGMFSFIIVAILVSTVKSKRREHSNDPYHQ>Y<IVED--WQEKYKSQILNL------------103
KCNE3MFLFAVTVGSLILGYTRSRKVDKRSDPYHV>Y<IKN---------------------------98
KCNE4MSFYGIFLIGIMLGYMKSKRREKKSSLLLL>Y<KDEERLWGEAMKPLPVVSGLRSVQVPLMLN103
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y81Cc.242A>G Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Denaturing high-performance liquid chromatography screening of the long QT syndrome-related cardiac sodium and potassium channel genes and identification of novel mutations and single nucleotide polymorphisms. J Hum Genet. 2005 50(9):490-6. 16155735
Inherited ArrhythmiaLQTS Characterization of an LQT5-related mutation in KCNE1, Y81C: implications for a role of KCNE1 cytoplasmic domain in IKs channel function. Heart Rhythm. 2006 3(9):1031-40. 16945797
p.Y81Fc.242A>T Putative BenignSIFT: deleterious
Polyphen: probably damaging
ReportsPutative Benign Stilbenes and fenamates rescue the loss of I(KS) channel function induced by an LQT5 mutation and other IsK mutants. EMBO J. 1999 18(15):4137-48. 10428953