Paralogue Annotation for KCNE1 residue 89

Residue details

Gene: KCNE1
Reference Sequences: LRG: LRG_290, Ensembl variant: ENST00000399289 / ENSP00000382228
Amino Acid Position: 89
Reference Amino Acid: E - Glutamate
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE1 residue 89

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE2E94GLong QT syndromeHigh9 19716085

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE1.



KCNE1GIMLSYIRSKKLEHSNDPFNVYIESDA-WQ>E<KDKAYVQARVLESYRSCYVV----------109
KCNE2AILVSTVKSKRREHSNDPYHQYIVED--WQ>E<KYKSQILNL---------------------103
KCNE3SLILGYTRSRKVDKRSDPYHVYIKN----->-<------------------------------98
KCNE4GIMLGYMKSKRREKKSSLLLLYKDEERLWG>E<AMKPLPVVSGLRSVQVPLMLNMLQESVAPA112
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE1

There are currently no reported variants at residue 89 for KCNE1.