Paralogue Annotation for KCNE2 residue 103
Residue details
Gene: KCNE2Reference Sequences: LRG:
LRG_291, Ensembl variant:
ENST00000290310 /
ENSP00000290310Amino Acid Position: 103
Reference Amino Acid: L - Leucine
Protein Domain: C-terminus
Paralogue Variants mapped to KCNE2 residue 103
| Paralogue | Variant | Associated Disease | Mapping Quality | Consensus | Pubmed | | KCNE1 | R98W | Long QT syndrome | Medium | 6 |
10973849, 19907016, 23861362 |
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to
check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing.
It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.
| KCNE2 | KRREHSNDPYHQYIVED--WQEKYKSQILN>L<------------------------------ | 103 |
| KCNE1 | KKLEHSNDPFNVYIESDA-WQEKDKAYVQA>R<VLESYRSCYVV------------------- | 109 |
| KCNE3 | RKVDKRSDPYHVYIKN-------------->-<------------------------------ | 98 |
| KCNE4 | KRREKKSSLLLLYKDEERLWGEAMKPLPVV>S<GLRSVQVPLMLNMLQESVAPALSCTLCSME | 121 |
| cons | > < | |
Known Variants in KCNE2
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|
| p.L103P | c.308T>C |
Putative Benign | | | SIFT:
Polyphen: |