Paralogue Annotation for KCNE2 residue 27

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 27
Reference Amino Acid: R - Arginine
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE2 residue 27

No paralogue variants have been mapped to residue 27 for KCNE2.



KCNE2LSN---FTQTLEDVFRRIFITYMDNW---->R<QNTTAEQEALQA-KVDAENFY--YVILYLM54
KCNE1ILS---NTTAVTPFLTKLWQE---T----->-<VQQGGN-MSGLA-RRSPRSSDGKLEALYVL48
KCNE3TNGTETWYESLHAVLKALNATLHSNLLCRP>G<PGLGPD-NQTEERRASLPGR-DDNSYMYIL62
KCNE4----------------MLKMEPLNST---->H<PGTAASSSPLES-RAAGGGSGNGNEYFYIL40
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R27Cc.79C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsOther Cardiac Phenotype Identification of a KCNE2 gain-of-function mutation in patients with familial atrial fibrillation. Am J Hum Genet. 2004 75(5):899-905. 15368194
Inherited ArrhythmiaLQTS Genetic polymorphisms in KCNQ1, HERG, KCNE1 and KCNE2 genes in the Chinese, Malay and Indian populations of Singapore. Br J Clin Pharmacol. 2006 61(3):301-8. 16487223
Other Cardiac Phenotype KCNE2 modulates cardiac L-type Ca(2+) channel. J Mol Cell Cardiol. 2014 72:208-18. doi: 10.1016/j.yjmcc.2014.03.013. 24681347
p.R27Hc.80G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Actionable, pathogenic incidental findings in 1,000 participants' exomes. Am J Hum Genet. 2013 93(4):631-40. doi: 10.1016/j.ajhg.2013.08.006. 24055113
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381