Paralogue Annotation for KCNE2 residue 39

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 39
Reference Amino Acid: A - Alanine
Protein Domain: N-terminus


Paralogue Variants mapped to KCNE2 residue 39

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE1R36HLong QT syndromeMedium4 16414944

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.



KCNE2DVFRRIFITYMDNW----RQNTTAEQEALQ>A<-KVDAENFY--YVILYLMVMIGMFSFIIVA66
KCNE1PFLTKLWQE---T------VQQGGN-MSGL>A<-RRSPRSSDGKLEALYVLMVLGFFGFFTLG60
KCNE3AVLKALNATLHSNLLCRPGPGLGPD-NQTE>E<RRASLPGR-DDNSYMYILFVMFLFAVTVGS74
KCNE4----MLKMEPLNST----HPGTAASSSPLE>S<-RAAGGGSGNGNEYFYILVVMSFYGIFLIG52
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A39Gc.116C>G Putative BenignSIFT:
Polyphen: