Paralogue Annotation for KCNE2 residue 60

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 60
Reference Amino Acid: F - Phenylalanine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE2 residue 60

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE1F54VSudden unexplained nocturnal death syndromeHigh9 23890619

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.



KCNE2EQEALQA-KVDAENFY--YVILYLMVMIGM>F<SFIIVAILVSTVKSKRREHSNDPYHQYIVE90
KCNE1N-MSGLA-RRSPRSSDGKLEALYVLMVLGF>F<GFFTLGIMLSYIRSKKLEHSNDPFNVYIES84
KCNE3D-NQTEERRASLPGR-DDNSYMYILFVMFL>F<AVTVGSLILGYTRSRKVDKRSDPYHVYIKN98
KCNE4SSSPLES-RAAGGGSGNGNEYFYILVVMSF>Y<GIFLIGIMLGYMKSKRREKKSSLLLLYKDE76
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F60Lc.178T>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
p.F60Ic.178T>A Putative BenignSIFT:
Polyphen: