Paralogue Annotation for KCNE2 residue 64

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 64
Reference Amino Acid: I - Isoleucine
Protein Domain: Transmembrane region


Paralogue Variants mapped to KCNE2 residue 64

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE1T58PLong QT syndromeMedium9 19716085

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.



KCNE2LQA-KVDAENFY--YVILYLMVMIGMFSFI>I<VAILVSTVKSKRREHSNDPYHQYIVED--W92
KCNE1GLA-RRSPRSSDGKLEALYVLMVLGFFGFF>T<LGIMLSYIRSKKLEHSNDPFNVYIESDA-W87
KCNE3TEERRASLPGR-DDNSYMYILFVMFLFAVT>V<GSLILGYTRSRKVDKRSDPYHVYIKN----98
KCNE4LES-RAAGGGSGNGNEYFYILVVMSFYGIF>L<IGIMLGYMKSKRREKKSSLLLLYKDEERLW80
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

There are currently no reported variants at residue 64 for KCNE2.