Paralogue Annotation for KCNE2 residue 77

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 77
Reference Amino Acid: R - Arginine
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE2 residue 77

No paralogue variants have been mapped to residue 77 for KCNE2.



KCNE2-YVILYLMVMIGMFSFIIVAILVSTVKSKR>R<EHSNDPYHQYIVED--WQEKYKSQILNL--103
KCNE1KLEALYVLMVLGFFGFFTLGIMLSYIRSKK>L<EHSNDPFNVYIESDA-WQEKDKAYVQARVL100
KCNE3DNSYMYILFVMFLFAVTVGSLILGYTRSRK>V<DKRSDPYHVYIKN-----------------98
KCNE4GNEYFYILVVMSFYGIFLIGIMLGYMKSKR>R<EKKSSLLLLYKDEERLWGEAMKPLPVVSGL93
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R77Qc.230G>A Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
p.R77Wc.229C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS Torsades de pointes complicating atrioventricular block: evidence for a genetic predisposition. Heart Rhythm. 2007 4(2):170-4. 17275752
Inherited ArrhythmiaLQTS High prevalence of genetic variants previously associated with LQT syndrome in new exome data. Eur J Hum Genet. 2012 20(8):905-8. doi: 10.1038/ejhg.2012.23. 22378279
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381