Paralogue Annotation for KCNE2 residue 90

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 90
Reference Amino Acid: E - Glutamate
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE2 residue 90

No paralogue variants have been mapped to residue 90 for KCNE2.



KCNE2FSFIIVAILVSTVKSKRREHSNDPYHQYIV>E<D--WQEKYKSQILNL---------------103
KCNE1FGFFTLGIMLSYIRSKKLEHSNDPFNVYIE>S<DA-WQEKDKAYVQARVLESYRSCYVV----109
KCNE3FAVTVGSLILGYTRSRKVDKRSDPYHVYIK>N<------------------------------98
KCNE4YGIFLIGIMLGYMKSKRREKKSSLLLLYKD>E<ERLWGEAMKPLPVVSGLRSVQVPLMLNMLQ106
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E90Gc.269A>G Other Cardiac PhenotypeSIFT: tolerated
Polyphen: benign
ReportsOther Cardiac Phenotype Amiodarone-associated macroscopic T-wave alternans and torsade de pointes unmasking the inherited long QT syndrome. Europace. 2008 10(1):112-3. 18006559