Paralogue Annotation for KCNE2 residue 91

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 91
Reference Amino Acid: D - Aspartate
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE2 residue 91

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNE1D85NLong QT syndrome ?High5 14760488, 15051636, 16132053, 17161064, 19695459, 20823649, 21244686, 21712262, 22100668, 22378279, 22995991, 22999324, 16823764, 23237912, 23631430, 24400172, 24561134, 25119684

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNE2.



KCNE2SFIIVAILVSTVKSKRREHSNDPYHQYIVE>D<--WQEKYKSQILNL----------------103
KCNE1GFFTLGIMLSYIRSKKLEHSNDPFNVYIES>D<A-WQEKDKAYVQARVLESYRSCYVV-----109
KCNE3AVTVGSLILGYTRSRKVDKRSDPYHVYIKN>-<------------------------------98
KCNE4GIFLIGIMLGYMKSKRREKKSSLLLLYKDE>E<RLWGEAMKPLPVVSGLRSVQVPLMLNMLQE107
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

There are currently no reported variants at residue 91 for KCNE2.