Paralogue Annotation for KCNE2 residue 94

Residue details

Gene: KCNE2
Reference Sequences: LRG: LRG_291, Ensembl variant: ENST00000290310 / ENSP00000290310
Amino Acid Position: 94
Reference Amino Acid: E - Glutamate
Protein Domain: C-terminus


Paralogue Variants mapped to KCNE2 residue 94

No paralogue variants have been mapped to residue 94 for KCNE2.



KCNE2AILVSTVKSKRREHSNDPYHQYIVED--WQ>E<KYKSQILNL---------------------103
KCNE1GIMLSYIRSKKLEHSNDPFNVYIESDA-WQ>E<KDKAYVQARVLESYRSCYVV----------109
KCNE3SLILGYTRSRKVDKRSDPYHVYIKN----->-<------------------------------98
KCNE4GIMLGYMKSKRREKKSSLLLLYKDEERLWG>E<AMKPLPVVSGLRSVQVPLMLNMLQESVAPA112
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNE2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E94Gc.281A>G Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085