Paralogue Annotation for RYR2 residue 3925
Residue details
Gene: RYR2Reference Sequences: LRG:
LRG_402, Ensembl variant:
ENST00000366574 /
ENSP00000355533Amino Acid Position: 3925
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region
Paralogue Variants mapped to RYR2 residue 3925
Paralogue | Variant | Associated Disease | Mapping Quality | Consensus | Pubmed | RYR1 | Q3969K | Central core disease | High | 9 |
25960145 |
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to
check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing.
It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.
RYR2 | KDVIDEQGQRNFSKAIQVAKQVFNTLTEYI>Q<GPCTGNQQSLAHSRLWDAVVGFLHVFAHMQ | 3955 |
RYR1 | KDVIEEQGKRNFSKAMSVAKQVFNSLTEYI>Q<GPCTGNQQSLAHSRLWDAVVGFLHVFAHMM | 3999 |
RYR3 | KDIIDESGQHNFSKALAVTKQIFNSLTEYI>Q<GPCIGNQQSLAHSRLWDAVVGFLHVFANMQ | 3851 |
cons | > < | |
Known Variants in RYR2
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|
p.Q3925E | c.11773C>G |
Inherited Arrhythmia | CPVT | | SIFT: deleterious Polyphen: probably damaging |
Reports | Inherited Arrhythmia | CPVT |
The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74.
19926015 |
Inherited Arrhythmia | CPVT |
New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118.
24025405 |
Other Cardiac Phenotype | |
Whole-Exome Molecular Autopsy After Exertion-Related Sudden Unexplained Death in the Young. Circ Cardiovasc Genet. 2016 9(3):259-65. doi: 10.1161/CIRCGENETICS.115.001370.
27114410 |