No paralogue variants have been mapped to residue 106 for KCNH2.
KCNH2 | ------DGS--------------------C>F<LCLVDVV----------------------- | 113 |
KCNH1 | ------NRT--------------------P>V<WFFVKIA----------------------- | 114 |
KCNH3 | ------SGL--------------------P>F<WCLLDVI----------------------- | 114 |
KCNH4 | ------DGS--------------------A>F<WCLLDMM----------------------- | 114 |
KCNH5 | ------NRT--------------------P>V<WFYMQIA----------------------- | 112 |
KCNH6 | ------DAS--------------------S>F<RCLVDVV----------------------- | 113 |
KCNH7 | ------NGS--------------------T>F<ICNTHII----------------------- | 113 |
KCNH8 | ------NGS--------------------P>F<WCLLDIV----------------------- | 114 |
CNGA1 | ------GSF--------------------S>Y<KSLRKG-G---------------------- | 75 |
CNGA2 | ------ADV--------------------D>-<APQQGRSG---------------------- | 65 |
CNGA3 | ------ADS--------------------G>Q<GSFTGQ-G---------------------- | 69 |
CNGA4 | ------------------------------>-<------------------------------ | |
CNGB1 | VLPQPPKSSEVWRDEPAVATGAASDPAPPG>R<PQEMGPKLQARETPSLPTPIPLQPKEEPKE | 229 |
CNGB3 | ------------------------------>-<------------------------------ | |
HCN1 | ------------------------------>-<------------------------------ | |
HCN2 | ------------------------------>-<------------------------------ | |
HCN3 | ------------------------------>-<------------------------------ | |
HCN4 | ------------------------------>-<------------------------------ | |
cons | > < |
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|---|---|---|---|---|
p.F106L | c.318C>A | Inherited Arrhythmia | LQTS | rs199473497 | SIFT: tolerated Polyphen: benign |
Reports | Inherited Arrhythmia | LQTS | Genotype-phenotype aspects of type 2 long QT syndrome. J Am Coll Cardiol. 2009 54(22):2052-62. 19926013 | ||
Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||
p.F106Y | c.317T>A | Inherited Arrhythmia | LQTS | rs199472858 | SIFT: deleterious Polyphen: benign |
Reports | Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | ||
Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 | |||
p.F106V | c.316T>G | Inherited Arrhythmia | LQTS | SIFT: Polyphen: | |
Reports | Inherited Arrhythmia | LQTS | Asymmetry of parental origin in long QT syndrome: preferential maternal transmission of KCNQ1 variants linked to channel dysfunction. Eur J Hum Genet. 2016 24(8):1160-6. doi: 10.1038/ejhg.2015.257. 26669661 |