No paralogue variants have been mapped to residue 114 for KCNH2.
KCNH2 | ------------------------------>P<VK---NEDGAVIMFILNFEVVMEKDM-VG- | 139 |
KCNH1 | ------------------------------>P<IR---NEQDKVVLFLCTFSDITAFKQ-PI- | 140 |
KCNH3 | ------------------------------>P<IK---NEKGEVALFLVSHKDISETK-NRG- | 140 |
KCNH4 | ------------------------------>P<IK---NEMGEVVLFLFSFKDITQSGSPGL- | 141 |
KCNH5 | ------------------------------>P<IR---NEHEKVVLFLCTFKDITLFKQ-PI- | 138 |
KCNH6 | ------------------------------>P<VK---NEDGAVIMFILNFEDLAQL------ | 135 |
KCNH7 | ------------------------------>P<VK---NQEGVAMMFIINFEYVTDNEN-AA- | 139 |
KCNH8 | ------------------------------>P<IK---NEKGDVVLFLASFKDITDTK-VKI- | 140 |
CNGA1 | ------------------------------>P<SQREQYLPGAIALFNVNNSSNKDQ------ | 100 |
CNGA2 | ------------------------------>-<FRRIVRLVGIIREWANKNFREEEP------ | 89 |
CNGA3 | ------------------------------>-<IARLSRLIFLLRRWAARHVHHQDQ------ | 93 |
CNGA4 | ------------------------------>-<----------------------DT------ | 5 |
CNGB1 | SLPPTRDPARLVAWVLHRLEMALPQPVLHG>K<IG---EQEPDSPGICDVQTISILPGG---Q | 299 |
CNGB3 | ------------------------------>-<------------------------------ | |
HCN1 | ------------------------------>-<-------------------GGGGGGG-GGG | 72 |
HCN2 | ------------------------------>-<-------------------GAASGPA-PGP | 138 |
HCN3 | ------------------------------>-<-------------------TAASGPI-PKS | 40 |
HCN4 | ------------------------------>-<-------------------QPSVDTA-IKV | 190 |
cons | > < |
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|---|---|---|---|---|
p.P114S | c.340C>T | Inherited Arrhythmia | LQTS | rs199472861 | SIFT: deleterious Polyphen: probably damaging |
Reports | Inherited Arrhythmia | LQTS | Notched T waves on Holter recordings enhance detection of patients with LQt2 (HERG) mutations. Circulation. 2001 103(8):1095-101. 11222472 | ||
Inherited Arrhythmia | LQTS | Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724 | |||
Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | |||
Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 |