Paralogue Annotation for KCNH2 residue 534

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 534
Reference Amino Acid: R - Arginine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 534

No paralogue variants have been mapped to residue 534 for KCNH2.



KCNH2----------------LIGLLKTARLLRLV>R<VARKLDRY-----SEYGAAV-LFLLMCTFA558
KCNH1-IPPPLEGRESQGISSLFSSLKVVRLLRLG>R<VARKLDHY-----IEYGAAV-LVLLVCVFG387
KCNH3-Y-------------FGAHLLKTVRLLRLL>R<LLPRLDRY-----SQYSAVV-LTLLMAVFA368
KCNH4-T-------------SLVHLLKTVRLLRLL>R<LLQKLERY-----SQCSAVV-LTLLMSVFA370
KCNH5-------------ISSLFSSLKVVRLLRLG>R<VARKLDHY-----LEYGAAV-LVLLVCVFG357
KCNH6-T-------------TLIGLLKTARLLRLV>R<VARKLDRY-----SEYGAAV-LFLLMCTFA409
KCNH7-T-------------TLIGLLKTARLLRLV>R<VARKLDRY-----SEYGAAV-LMLLMCIFA560
KCNH8-V-------------SLVHLLKTVRLLRLL>R<LLQKLDRY-----SQHSTIV-LTLLMSMFA364
CNGA1---------------PEIRLNRLLRFSRMF>E<FFQRTETR-----TNYPNIFRISNLVMYIV308
CNGA2---------------PEVRFNRLLHFARMF>E<FFDRTETR-----TNYPNIFRISNLVLYIL283
CNGA3---------------PEVRFNRLLKFSRLF>E<FFDRTETR-----TNYPNMFRIGNLVLYIL311
CNGA4---------------PTLRLNRFLRAPRLF>E<AFDRTETR-----TAYPNAFRIAKLMLYIF177
CNGB1---------------PLLRLPRCLKYMAFF>E<FNSRLESI-----LSKAYVYRVIRTTAYLL799
CNGB3---------------PMFRANRMLKYTSFF>E<FNHHLESI-----MDKAYIYRVIRTTGYLL361
HCN1FT-------------KILSLLRLLRLSRLI>R<YIHQWEEIFHMTYDLASAVVRIFNLIGMML306
HCN2FT-------------KILSLLRLLRLSRLI>R<YIHQWEEIFHMTYDLASAVMRICNLISMML375
HCN3FT-------------KILSLLRLLRLSRLI>R<YIHQWEEIFHMTYDLASAVVRIFNLIGMML259
HCN4FT-------------KILSLLRLLRLSRLI>R<YIHQWEEIFHMTYDLASAVVRIVNLIGMML426
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R534Cc.1600C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Genomic organization and mutational analysis of HERG, a gene responsible for familial long QT syndrome. Hum Genet. 1998 102(4):435-9. 9600240
Inherited ArrhythmiaLQTS Voltage-shift of the current activation in HERG S4 mutation (R534C) in LQT2. Cardiovasc Res. 1999 44(2):283-93. 10690305
Inherited ArrhythmiaLQTS Identical twins with long QT syndrome associated with a missense mutation in the S4 region of the HERG. Jpn Heart J. 2000 41(3):399-404. 10987356
Inherited ArrhythmiaLQTS Screening for mutations and polymorphisms in the genes KCNH2 and KCNE2 encoding the cardiac HERG/MiRP1 ion channel: implications for acquired and congenital long Q-T syndrome. Clin Chem. 2001 47(8):1390-5. 11468227
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Most LQT2 mutations reduce Kv11.1 (hERG) current by a class 2 (trafficking-deficient) mechanism. Circulation. 2006 113(3):365-73. 16432067
Inherited ArrhythmiaLQTS [Novel mutations of potassium channel KCNQ1 S145L and KCNH2 Y475C genes in Chinese pedigrees of long QT syndrome]. Zhonghua Nei Ke Za Zhi. 2006 45(6):463-6. 16831322
Inherited ArrhythmiaLQTS Long QT and Brugada syndrome gene mutations in New Zealand. Heart Rhythm. 2007 4(10):1306-14. 17905336
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS An in vivo cardiac assay to determine the functional consequences of putative long QT syndrome mutations. Circ Res. 2013 112(5):826-30. doi: 10.1161/CIRCRESAHA.112.300664. 23303164
p.R534Lc.1601G>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Genetic testing in the long QT syndrome: development and validation of an efficient approach to genotyping in clinical practice. JAMA. 2005 294(23):2975-80. 16414944
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Mechanistic basis for type 2 long QT syndrome caused by KCNH2 mutations that disrupt conserved arginine residues in the voltage sensor. J Membr Biol. 2013 246(5):355-64. doi: 10.1007/s00232-013-9539-6. 23546015
p.Arg534Serc.1600C>A UnknownSIFT:
Polyphen: