Paralogue Annotation for KCNH2 residue 552

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 552
Reference Amino Acid: L - Leucine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 552

No paralogue variants have been mapped to residue 552 for KCNH2.



KCNH2RLLRLVRVARKLDRY-----SEYGAAV-LF>L<LMCTFALIAHWLACIWYAIGNMEQPHMDSR582
KCNH1RLLRLGRVARKLDHY-----IEYGAAV-LV>L<LVCVFGLAAHWMACIWYSIGDYEIFDEDTK411
KCNH3RLLRLLRLLPRLDRY-----SQYSAVV-LT>L<LMAVFALLAHWVACVWFYIGQREIESSESE392
KCNH4RLLRLLRLLQKLERY-----SQCSAVV-LT>L<LMSVFALLAHWMACIWYVIGRREMEANDPL394
KCNH5RLLRLGRVARKLDHY-----LEYGAAV-LV>L<LVCVFGLVAHWLACIWYSIGDYEVIDEVTN381
KCNH6RLLRLVRVARKLDRY-----SEYGAAV-LF>L<LMCTFALIAHWLACIWYAIGNVERPYLEHK433
KCNH7RLLRLVRVARKLDRY-----SEYGAAV-LM>L<LMCIFALIAHWLACIWYAIGNVERPYLTDK584
KCNH8RLLRLLRLLQKLDRY-----SQHSTIV-LT>L<LMSMFALLAHWMACIWYVIGKMEREDNSLL388
CNGA1RFSRMFEFFQRTETR-----TNYPNIFRIS>N<LVMYIVIIIHWNACVFYSISKAIGFGND--330
CNGA2HFARMFEFFDRTETR-----TNYPNIFRIS>N<LVLYILVIIHWNACIYYAISKSIGFGVD--305
CNGA3KFSRLFEFFDRTETR-----TNYPNMFRIG>N<LVLYILIIIHWNACIYFAISKFIGFGTD--333
CNGA4RAPRLFEAFDRTETR-----TAYPNAFRIA>K<LMLYIFVVIHWNSCLYFALSRYLGFGRD--199
CNGB1KYMAFFEFNSRLESI-----LSKAYVYRVI>R<TTAYLLYSLHLNSCLYYWASAYQGLGST--821
CNGB3KYTSFFEFNHHLESI-----MDKAYIYRVI>R<TTGYLLFILHINACVYYWASNYEGIGTT--383
HCN1RLSRLIRYIHQWEEIFHMTYDLASAVVRIF>N<LIGMMLLLCHWDGCLQFLVPLLQDFPPD--328
HCN2RLSRLIRYIHQWEEIFHMTYDLASAVMRIC>N<LISMMLLLCHWDGCLQFLVPMLQDFPRN--397
HCN3RLSRLIRYIHQWEEIFHMTYDLASAVVRIF>N<LIGMMLLLCHWDGCLQFLVPMLQDFPPD--281
HCN4RLSRLIRYIHQWEEIFHMTYDLASAVVRIV>N<LIGMMLLLCHWDGCLQFLVPMLQDFPDD--448
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L552Sc.1655T>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Sinus node function and ventricular repolarization during exercise stress test in long QT syndrome patients with KvLQT1 and HERG potassium channel defects. J Am Coll Cardiol. 1999 34(3):823-9. 10483966
Inherited ArrhythmiaLQTS Homozygosity for a HERG potassium channel mutation causes a severe form of long QT syndrome: identification of an apparent founder mutation in the Finns. J Am Coll Cardiol. 2000 35(7):1919-25. 10841244
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Increased risk of arrhythmic events in long-QT syndrome with mutations in the pore region of the human ether-a-go-go-related gene potassium channel. Circulation. 2002 105(7):794-9. 11854117
Inherited ArrhythmiaLQTS Death in bathtub revisited with molecular genetics: a victim with suicidal traits and a LQTS gene mutation. Forensic Sci Int. 2002 130(2-3):122-4. 12477631
Inherited ArrhythmiaLQTS Molecular screening of selected long QT syndrome (LQTS) mutations in 165 consecutive bodies found in water. Int J Legal Med. 2003 117(2):115-7. 12690509
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS High prevalence of four long QT syndrome founder mutations in the Finnish population. Ann Med. 2009 41(3):234-40. 19160088
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
Inherited ArrhythmiaLQTS Identification of Medically Actionable Secondary Findings in the 1000 Genomes. PLoS One. 2015 10(9):e0135193. doi: 10.1371/journal.pone.0135193. 26332594