Paralogue Annotation for KCNH2 residue 561

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 561
Reference Amino Acid: A - Alanine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 561

No paralogue variants have been mapped to residue 561 for KCNH2.



KCNH2RKLDRY-----SEYGAAV-LFLLMCTFALI>A<HWLACIWYAIGNMEQPHMDSR----IGWLH587
KCNH1RKLDHY-----IEYGAAV-LVLLVCVFGLA>A<HWMACIWYSIGDYEIFDEDTKTIRNNSWLY420
KCNH3PRLDRY-----SQYSAVV-LTLLMAVFALL>A<HWVACVWFYIGQREIESSESELPE-IGWLQ400
KCNH4QKLERY-----SQCSAVV-LTLLMSVFALL>A<HWMACIWYVIGRREMEANDPLLWD-IGWLH402
KCNH5RKLDHY-----LEYGAAV-LVLLVCVFGLV>A<HWLACIWYSIGDYEVIDEVTNTIQIDSWLY390
KCNH6RKLDRY-----SEYGAAV-LFLLMCTFALI>A<HWLACIWYAIGNVERPYLEHK----IGWLD438
KCNH7RKLDRY-----SEYGAAV-LMLLMCIFALI>A<HWLACIWYAIGNVERPYLTDK----IGWLD589
KCNH8QKLDRY-----SQHSTIV-LTLLMSMFALL>A<HWMACIWYVIGKMEREDNSLLKWE-VGWLH396
CNGA1QRTETR-----TNYPNIFRISNLVMYIVII>I<HWNACVFYSISKAIGFGND-------TWVY334
CNGA2DRTETR-----TNYPNIFRISNLVLYILVI>I<HWNACIYYAISKSIGFGVD-------TWVY309
CNGA3DRTETR-----TNYPNMFRIGNLVLYILII>I<HWNACIYFAISKFIGFGTD-------SWVY337
CNGA4DRTETR-----TAYPNAFRIAKLMLYIFVV>I<HWNSCLYFALSRYLGFGRD-------AWVY203
CNGB1SRLESI-----LSKAYVYRVIRTTAYLLYS>L<HLNSCLYYWASAYQGLGST-------HWVY825
CNGB3HHLESI-----MDKAYIYRVIRTTGYLLFI>L<HINACVYYWASNYEGIGTT-------RWVY387
HCN1HQWEEIFHMTYDLASAVVRIFNLIGMMLLL>C<HWDGCLQFLVPLLQDFPPD-------CWVS332
HCN2HQWEEIFHMTYDLASAVMRICNLISMMLLL>C<HWDGCLQFLVPMLQDFPRN-------CWVS401
HCN3HQWEEIFHMTYDLASAVVRIFNLIGMMLLL>C<HWDGCLQFLVPMLQDFPPD-------CWVS285
HCN4HQWEEIFHMTYDLASAVVRIVNLIGMMLLL>C<HWDGCLQFLVPMLQDFPDD-------CWVS452
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A561Pc.1681G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS A common antitussive drug, clobutinol, precipitates the long QT syndrome 2. Mol Pharmacol. 2004 66(5):1093-102. 15280442
Inherited ArrhythmiaLQTS Mutation in the KCNQ1 gene leading to the short QT-interval syndrome. Circulation. 2004 109(20):2394-7. 15159330
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
p.A561Tc.1681G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS A mutation in HERG associated with notched T waves in long QT syndrome. J Mol Cell Cardiol. 1996 28(8):1609-15. 8877771
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Notched T waves on Holter recordings enhance detection of patients with LQt2 (HERG) mutations. Circulation. 2001 103(8):1095-101. 11222472
Inherited ArrhythmiaLQTS Increased risk of arrhythmic events in long-QT syndrome with mutations in the pore region of the human ether-a-go-go-related gene potassium channel. Circulation. 2002 105(7):794-9. 11854117
Other Cardiac Phenotype Postmortem molecular screening in unexplained sudden death. J Am Coll Cardiol. 2004 43(9):1625-9. 15120823
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Gene sequencing in neonates and infants with the long QT syndrome. Genet Test. 2005 9(4):281-4. 16379539
Inherited ArrhythmiaLQTS Most LQT2 mutations reduce Kv11.1 (hERG) current by a class 2 (trafficking-deficient) mechanism. Circulation. 2006 113(3):365-73. 16432067
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS An in vivo cardiac assay to determine the functional consequences of putative long QT syndrome mutations. Circ Res. 2013 112(5):826-30. doi: 10.1161/CIRCRESAHA.112.300664. 23303164
Inherited ArrhythmiaLQTS Allele-specific RNA interference rescues the long-QT syndrome phenotype in human-induced pluripotency stem cell cardiomyocytes. Eur Heart J. 2014 35(16):1078-87. doi: 10.1093/eurheartj/eht067. 23470493
p.A561Vc.1682C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS A molecular basis for cardiac arrhythmia: HERG mutations cause long QT syndrome. Cell. 1995 80(5):795-803. 7889573
Inherited ArrhythmiaLQTS Low penetrance in the long-QT syndrome: clinical impact. Circulation. 1999 99(4):529-33. 9927399
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Retention in the endoplasmic reticulum as a mechanism of dominant-negative current suppression in human long QT syndrome. J Mol Cell Cardiol. 2000 32(12):2327-37. 11113008
Inherited ArrhythmiaLQTS Screening for mutations and polymorphisms in the genes KCNH2 and KCNE2 encoding the cardiac HERG/MiRP1 ion channel: implications for acquired and congenital long Q-T syndrome. Clin Chem. 2001 47(8):1390-5. 11468227
Inherited ArrhythmiaLQTS Automated mutation screening using dideoxy fingerprinting and capillary array electrophoresis. Hum Mutat. 2001 18(5):451-7. 11668638
Inherited ArrhythmiaLQTS Increased risk of arrhythmic events in long-QT syndrome with mutations in the pore region of the human ether-a-go-go-related gene potassium channel. Circulation. 2002 105(7):794-9. 11854117
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Most LQT2 mutations reduce Kv11.1 (hERG) current by a class 2 (trafficking-deficient) mechanism. Circulation. 2006 113(3):365-73. 16432067
Inherited ArrhythmiaLQTS [Construction of eukaryotic expression vector of congenital long QT syndrome related HERG gene A561V mutation and its expression in HEK293 cells]. Zhonghua Yi Xue Yi Chuan Xue Za Zhi. 2006 23(6):627-30. 17160940
Inherited ArrhythmiaLQTS [Functional expression of congenital long QT syndrome related HERG mutation A561V in vitro]. Zhonghua Xin Xue Guan Bing Za Zhi. 2007 35(2):143-6. 17445409
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Functional studies on three novel HCNH2 mutations in Taiwan: identification of distinct mechanisms of channel defect and dissociation between glycosylation defect and assembly defect. Biochem Biophys Res Commun. 2008 373(4):572-8. 18593567
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Four novel KVLQT1 and four novel HERG mutations in familial long-QT syndrome. Circulation. 1997 95(3):565-7. 9024139
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS An in vivo cardiac assay to determine the functional consequences of putative long QT syndrome mutations. Circ Res. 2013 112(5):826-30. doi: 10.1161/CIRCRESAHA.112.300664. 23303164
Unknown The dominant negative LQT2 mutation A561V reduces wild-type HERG expression. J Biol Chem. 2000 275(15):11241-8. 10753933
Inherited ArrhythmiaLQTS Re-trafficking of hERG reverses long QT syndrome 2 phenotype in human iPS-derived cardiomyocytes. Cardiovasc Res. 2014 102(3):497-506. doi: 10.1093/cvr/cvu060. 24623279
Inherited ArrhythmiaLQTS Association of the hERG mutation with long-QT syndrome type 2, syncope and epilepsy. Mol Med Rep. 2016 13(3):2467-75. doi: 10.3892/mmr.2016.4859. 26847485