Paralogue Annotation for KCNH2 residue 613

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 613
Reference Amino Acid: T - Threonine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 613

No paralogue variants have been mapped to residue 613 for KCNH2.



KCNH2G------------------LGGPSIKDKYV>T<ALYFTFSSLTSVGFGNVSPNTNSEKIFSIC643
KCNH1G-----------S--GK-WEGGPSKNSVYI>S<SLYFTMTSLTSVGFGNIAPSTDIEKIFAVA482
KCNH3GQSDNCSSSSEANGTGLELLGGPSLRSAYI>T<SLYFALSSLTSVGFGNVSANTDTEKIFSIC484
KCNH4------------------SVGGPSRRSAYI>A<ALYFTLSSLTSVGFGNVCANTDAEKIFSIC458
KCNH5S-----------A--GI-WEGGPSKDSLYV>S<SLYFTMTSLTTIGFGNIAPTTDVEKMFSVA451
KCNH6D-----------P------ASGPSVQDKYV>T<ALYFTFSSLTSVGFGNVSPNTNSEKVFSIC495
KCNH7D-----------S------SSGPSIKDKYV>T<ALYFTFSSLTSVGFGNVSPNTNSEKIFSIC646
KCNH8------------------TLGGPSIRSAYI>A<ALYFTLSSLTSVGFGNVSANTDAEKIFSIC453
CNGA1--------------------EFGRLARKYV>Y<SLYWSTLTLTTIG-ETPPPVRDSEYVFVVV380
CNGA2--------------------EYGYLAREYI>Y<CLYWSTLTLTTIG-ETPPPVKDEEYLFVIF355
CNGA3--------------------EHGRLSRKYI>Y<SLYWSTLTLTTIG-ETPPPVKDEEYLFVVV383
CNGA4--------------------GFERLRRQYL>Y<SFYFSTLILTTVG-DTPPPAREEEYLFMVG249
CNGB1-----------------------GVGNSYI>R<CYYFAVKTLITIG-GLPDPKTLFEIVFQLL863
CNGB3-----------------------GEGNEYL>R<CYYWAVRTLITIG-GLPEPQTLFEIVFQLL425
HCN1--------------------VNDSWGKQYS>Y<ALFKAMSHMLCIGYGAQAPVSMSDLWITML377
HCN2--------------------VNHSWSELYS>F<ALFKAMSHMLCIGYGRQAPESMTDIWLTML446
HCN3--------------------VNHSWGRQYS>H<ALFKAMSHMLCIGYGQQAPVGMPDVWLTML330
HCN4--------------------VNNSWGKQYS>Y<ALFKAMSHMLCIGYGRQAPVGMSDVWLTML497
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T613Mc.1838C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Novel KCNQ1 and HERG missense mutations in Dutch long-QT families. Hum Mutat. 1999 13(4):301-10. 10220144
Inherited ArrhythmiaLQTS Survey of the coding region of the HERG gene in long QT syndrome reveals six novel mutations and an amino acid polymorphism with possible phenotypic effects. Hum Mutat. 2000 15(6):580-1. 10862094
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Notched T waves on Holter recordings enhance detection of patients with LQt2 (HERG) mutations. Circulation. 2001 103(8):1095-101. 11222472
Inherited ArrhythmiaLQTS Increased risk of arrhythmic events in long-QT syndrome with mutations in the pore region of the human ether-a-go-go-related gene potassium channel. Circulation. 2002 105(7):794-9. 11854117
Inherited ArrhythmiaLQTS The use of genotype-phenotype correlations in mutation analysis for the long QT syndrome. J Med Genet. 2003 40(2):141-5. 12566525
Other Cardiac Phenotype Long QT syndrome in neonates: conduction disorders associated with HERG mutations and sinus bradycardia with KCNQ1 mutations. J Am Coll Cardiol. 2004 43(5):826-30. 14998624
Inherited ArrhythmiaLQTS Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Gene sequencing in neonates and infants with the long QT syndrome. Genet Test. 2005 9(4):281-4. 16379539
Inherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS Whole blood RNA offers a rapid, comprehensive approach to genetic diagnosis of cardiovascular diseases. Genet Med. 2007 9(1):23-33. 17224687
Inherited ArrhythmiaLQTS Mutation site dependent variability of cardiac events in Japanese LQT2 form of congenital long-QT syndrome. Circ J. 2008 72(5):694-9. 18441445
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Other Cardiac Phenotype Fetal ventricular tachycardia secondary to long QT syndrome treated with maternal intravenous magnesium: case report and review of the literature. Ultrasound Obstet Gynecol. 2009 34(4):475-80. 19731233
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Sodium-channel blockers might contribute to the prevention of ventricular tachycardia in patients with long QT syndrome type 2: a description of 4 cases. J Electrocardiol. 2012 45(3):237-43. 22402334
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
Inherited ArrhythmiaLQTS A patient with LQTS in whom verapamil administration and permanent pacemaker implantation were useful for preventing torsade de pointes. Pacing Clin Electrophysiol. 2004 27(1):123-4. 14720170
p.T613Kc.1838C>A Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Arrhythmia phenotype during fetal life suggests long-QT syndrome genotype: risk stratification of perinatal long-QT syndrome. Circ Arrhythm Electrophysiol. 2013 6(5):946-51. doi: 10.1161/CIRCEP.113.000618. 23995044
p.T613Ac.1837A>G Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS The Mutation P.T613a in the Pore Helix of the Kv 11.1 Potassium Channel is Associated with Long Qt Syndrome. Pacing Clin Electrophysiol. 2015 26173150
p.Thr613Serc.1837A>T UnknownSIFT:
Polyphen: