Paralogue Annotation for KCNH2 residue 626

Residue details

Gene: KCNH2
Reference Sequences: LRG: LRG_288, Ensembl variant: ENST00000262186 / ENSP00000262186
Amino Acid Position: 626
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNH2 residue 626

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
CNGA3G367VAchromatopsiaHigh9 20506298
CNGA1G364DRetinitis pigmentosaHigh9 25775262

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNH2.



KCNH2------LGGPSIKDKYVTALYFTFSSLTSV>G<FGNVSPNTNSEKIFSICVMLIGSLMYASIF656
KCNH1--GK-WEGGPSKNSVYISSLYFTMTSLTSV>G<FGNIAPSTDIEKIFAVAIMMIGSLLYATIF495
KCNH3GTGLELLGGPSLRSAYITSLYFALSSLTSV>G<FGNVSANTDTEKIFSICTMLIGALMHAVVF497
KCNH4-----SVGGPSRRSAYIAALYFTLSSLTSV>G<FGNVCANTDAEKIFSICTMLIGALMHAVVF471
KCNH5--GI-WEGGPSKDSLYVSSLYFTMTSLTTI>G<FGNIAPTTDVEKMFSVAMMMVGSLLYATIF464
KCNH6------ASGPSVQDKYVTALYFTFSSLTSV>G<FGNVSPNTNSEKVFSICVMLIGSLMYASIF508
KCNH7------SSGPSIKDKYVTALYFTFSSLTSV>G<FGNVSPNTNSEKIFSICVMLIGSLMYASIF659
KCNH8-----TLGGPSIRSAYIAALYFTLSSLTSV>G<FGNVSANTDAEKIFSICTMLIGALMHALVF466
CNGA1-------EFGRLARKYVYSLYWSTLTLTTI>G<-ETPPPVRDSEYVFVVVDFLIGVLIFATIV393
CNGA2-------EYGYLAREYIYCLYWSTLTLTTI>G<-ETPPPVKDEEYLFVIFDFLIGVLIFATIV368
CNGA3-------EHGRLSRKYIYSLYWSTLTLTTI>G<-ETPPPVKDEEYLFVVVDFLVGVLIFATIV396
CNGA4-------GFERLRRQYLYSFYFSTLILTTV>G<-DTPPPAREEEYLFMVGDFLLAVMGFATIM262
CNGB1----------GVGNSYIRCYYFAVKTLITI>G<-GLPDPKTLFEIVFQLLNYFTGVFAFSVMI876
CNGB3----------GEGNEYLRCYYWAVRTLITI>G<-GLPEPQTLFEIVFQLLNFFSGVFVFSSLI438
HCN1-------VNDSWGKQYSYALFKAMSHMLCI>G<YGAQAPVSMSDLWITMLSMIVGATCYAMFV390
HCN2-------VNHSWSELYSFALFKAMSHMLCI>G<YGRQAPESMTDIWLTMLSMIVGATCYAMFI459
HCN3-------VNHSWGRQYSHALFKAMSHMLCI>G<YGQQAPVGMPDVWLTMLSMIVGATCYAMFI343
HCN4-------VNNSWGKQYSYALFKAMSHMLCI>G<YGRQAPVGMSDVWLTMLSMIVGATCYAMFI510
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNH2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G626Ac.1877G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Genetic testing in the long QT syndrome: development and validation of an efficient approach to genotyping in clinical practice. JAMA. 2005 294(23):2975-80. 16414944
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
p.G626Dc.1877G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
p.G626Sc.1876G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS New missense mutation (G626V) in the predicted selectivity filter of the HERG channel associated with familial long QT syndrome. Hum Mutat. 2000 15(6):584. 10862104
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810
p.G626Vc.1877G>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS New missense mutation (G626V) in the predicted selectivity filter of the HERG channel associated with familial long QT syndrome. Hum Mutat. 2000 15(6):584. 10862104
Inherited ArrhythmiaLQTS Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810