No paralogue variants have been mapped to residue 98 for KCNH2.
KCNH2 | -----------GAEE-R-------KVE-IA>F<YRK-----------DGS------------- | 104 |
KCNH1 | -----------NYEM-N-------SFE-IL>M<YKK-----------NRT------------- | 105 |
KCNH3 | -----------EHKE-F-------KAE-LI>L<YRK-----------SGL------------- | 105 |
KCNH4 | -----------GHQE-H-------RAE-IC>F<YRK-----------DGS------------- | 105 |
KCNH5 | -----------NYES-N-------CFE-VL>L<YKK-----------NRT------------- | 103 |
KCNH6 | -----------GAEE-C-------KVD-IL>Y<YRK-----------DAS------------- | 104 |
KCNH7 | -----------GSEE-R-------KVE-VT>Y<YHK-----------NGS------------- | 104 |
KCNH8 | -----------EKTE-F-------KGE-IM>F<YKK-----------NGS------------- | 105 |
CNGA1 | -----------EDDD-SASTSEESENEN-P>H<A-R-----------GSF------------- | 66 |
CNGA2 | -----------AADDDTSSE---------L>Q<R-L-----------ADV------------- | 56 |
CNGA3 | -----------SSEE-TSSVLQPGIAME-T>R<G-L-----------ADS------------- | 60 |
CNGA4 | ------------------------------>-<------------------------------ | |
CNGB1 | -----------AQDT-R-------PGLRLL>L<WLEQNLERVLPQPPKSSEVWRDEPAVATGA | 190 |
CNGB3 | ------------------------------>-<------------------------------ | |
HCN1 | RLGTPPGGGGAGAKE-H-------GNS-VC>F<KVD--------------------------- | 62 |
HCN2 | RGEPQCSPAGPEGPA-R-------GPK-VS>F<SCR--------------------------- | 128 |
HCN3 | -----------------------------A>P<PPA--------------------------- | 30 |
HCN4 | ------------------------------>A<SCE--------------------------- | 180 |
cons | > < |
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|---|---|---|---|---|
p.F98S | c.293T>C | Inherited Arrhythmia | LQTS | SIFT: Polyphen: | |
Reports | Inherited Arrhythmia | LQTS | Results of genetic testing in 855 consecutive unrelated patients referred for long QT syndrome in a clinical laboratory. Genet Test Mol Biomarkers. 2013 17(7):553-61. doi: 10.1089/gtmb.2012.0118. 23631430 | ||
Inherited Arrhythmia | LQTS | Large-scale mutational analysis of Kv11.1 reveals molecular insights into type 2 long QT syndrome. Nat Commun. 2014 5:5535. doi: 10.1038/ncomms6535. 25417810 |