Paralogue Annotation for KCNQ1 residue 243

Residue details

Gene: KCNQ1
Reference Sequences: LRG: LRG_287, Ensembl variant: ENST00000155840 / ENSP00000155840
Amino Acid Position: 243
Reference Amino Acid: R - Arginine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNQ1 residue 243

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNQ2R213WEpilepsy, benign neonatalHigh9 18353052, 22455920, 23440208
KCNA1R307CEpisodic ataxia 1High9 20660867
KCNQ2R213QEpileptic encephalopathy, neonatalHigh9 22275249, 22455920, 23440208, 24318194, 25982755

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNQ1.



KCNQ1----SKGQVFATSAIRGIRFLQILRMLHVD>R<QGGTWRLLGSVVFIHRQELITTLYIGFLGL273
KCNQ2----SQGNVFATSALRSLRFLQILRMIRMD>R<RGGTWKLLGSVVYAHSKELVTAWYIGFLCL243
KCNQ3----NQGNVLA-TSLRSLRFLQILRMLRMD>R<RGGTWKLLGSAICAHSKELITAWYIGFLTL272
KCNQ4----TQGNIFATSALRSMRFLQILRMVRMD>R<RGGTWKLLGSVVYAHSKELITAWYIGFLVL249
KCNQ5----TQGNIFATSALRSLRFLQILRMVRMD>R<RGGTWKLLGSVVYAHSKELITAWYIGFLVL277
KCNA1-N-QKGEQATSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGQTLKASMRELGLLIFFLFIGV337
KCNA10----SAQQNMSLAILRIIRLVRVFRIFKLS>R<HSKGLQILGQTLKASMRELGLLIFFLFIGV386
KCNA2-DAQQGQQAMSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGQTLKASMRELGLLIFFLFIGV339
KCNA3---GNGQQAMSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGQTLKASMRELGLLIFFLFIGV409
KCNA4-GNGQQQQAMSFAILRIIRLVRVFRIFKLS>R<HSKGLQILGHTLRASMRELGLLIFFLFIGV489
KCNA5GGGQNGQQAMSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGKTLQASMRELGLLIFFLFIGV445
KCNA6GGGQNGQQAMSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGKTLQASMRELGLLIFFLFIGV387
KCNA7---GVGQQAMSLAILRVIRLVRVFRIFKLS>R<HSKGLQILGQTLRASMRELGLLIFFLFIGV323
KCNB1--KSVLQFQNVRRVVQIFRIMRILRILKLA>R<HSTGLQSLGFTLRRSYNELGLLILFLAMGI342
KCNB2--KSVLQFQNVRRVVQIFRIMRILRILKLA>R<HSTGLQSLGFTLRRSYNELGLLILFLAMGI346
KCNC1--LSSKAAKDVLGFLRVVRFVRILRIFKLT>R<HFVGLRVLGHTLRASTNEFLLLIIFLALGV356
KCNC2--LSSKAAKDVLGFLRVVRFVRILRIFKLT>R<HFVGLRVLGHTLRASTNEFLLLIIFLALGV393
KCNC3--LSSKAAKDVLGFLRVVRFVRILRIFKLT>R<HFVGLRVLGHTLRASTNEFLLLIIFLALGV459
KCNC4--LSSKAARDVLGFLRVVRFVRILRIFKLT>R<HFVGLRVLGHTLRASTNEFLLLIIFLALGV392
KCND1------KNDDVSGAFVTLRVFRVFRIFKFS>R<HSQGLRILGYTLKSCASELGFLLFSLTMAI337
KCND2------DNEDVSGAFVTLRVFRVFRIFKFS>R<HSQGLRILGYTLKSCASELGFLLFSLTMAI335
KCND3------NNEDVSGAFVTLRVFRVFRIFKFS>R<HSQGLRILGYTLKSCASELGFLLFSLTMAI332
KCNF1-GARMMELTNVQQAVQALRIMRIARIFKLA>R<HSSGLQTLTYALKRSFKELGLLLMYLAVGI335
KCNG1PGAGNSYLDKVGLVLRVLRALRILYVMRLA>R<HSLGLQTLGLTARRCTREFGLLLLFLCVAI388
KCNG2GPGGTKLLERAGLVLRLLRALRVLYVMRLA>R<HSLGLRSLGLTMRRCAREFGLLLLFLCVAM333
KCNG3FTGENSQLQRAGVTLRVLRMMRIFWVIKLA>R<HFIGLQTLGLTLKRCYREMVMLLVFICVAM334
KCNG4RPSGSSYLEKVGLVLRVLRALRILYVMRLA>R<HSLGLQTLGLTVRRCTREFGLLLLFLAVAI382
KCNS1--QGGKEFGHLGKVVQVFRLMRIFRVLKLA>R<HSTGLRSLGATLKHSYREVGILLLYLAVGV387
KCNS2--ESTPTLANLGRVAQVLRLMRIFRILKLA>R<HSTGLRSLGATLKYSYKEVGLLLLYLSVGI340
KCNS3--EESEDIENMGKVVQILRLMRIFRILKLA>R<HSVGLRSLGATLRHSYHEVGLLLLFLSVGI335
KCNV1--QTTQELENVGRIVQVLRLLRALRMLKLG>R<HSTGLRSLGMTITQCYEEVGLLLLFLSVGI357
KCNV2RGQTVGSVGKVGQVLRVMRLMRIFRILKLA>R<HSTGLRAFGFTLRQCYQQVGCLLLFIAMGI422
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNQ1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R243Cc.727C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Long QT syndrome-associated mutations in the S4-S5 linker of KvLQT1 potassium channels modify gating and interaction with minK subunits. J Biol Chem. 1999 274(30):21063-70. 10409658
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Catecholamine-provoked microvoltage T wave alternans in genotyped long QT syndrome. Pacing Clin Electrophysiol. 2003 26(8):1660-7. 12877697
Inherited ArrhythmiaLQTS Location of mutation in the KCNQ1 and phenotypic presentation of long QT syndrome. J Cardiovasc Electrophysiol. 2003 14(11):1149-53. 14678125
Inherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaLQTS Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS PKA and PKC partially rescue long QT type 1 phenotype by restoring channel-PIP2 interactions. Channels (Austin). 2010 4(1):3-11. 19934648
Inherited ArrhythmiaLQTS Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419
Inherited ArrhythmiaLQTS Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695
Inherited ArrhythmiaLQTS Mutations in cytoplasmic loops of the KCNQ1 channel and the risk of life-threatening events: implications for mutation-specific response to β-blocker therapy in type 1 long-QT syndrome. Circulation. 2012 125(16):1988-96. 22456477
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS Posthumous diagnosis of long QT syndrome from neonatal screening cards. Heart Rhythm. 2010 7(4):481-6. 20167303
Inherited ArrhythmiaLQTS RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159
p.R243Hc.728G>A Inherited ArrhythmiaLQTS,JLNSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Molecular genetics of the long QT syndrome: two novel mutations of the KVLQT1 gene and phenotypic expression of the mutant gene in a large kindred. Hum Mutat. 1998 11(2):158-65. 9482580
Inherited ArrhythmiaJLNS Mutations in a dominant-negative isoform correlate with phenotype in inherited cardiac arrhythmias. Am J Hum Genet. 1999 64(4):1015-23. 10090886
Inherited ArrhythmiaJLNS A spectrum of functional effects for disease causing mutations in the Jervell and Lange-Nielsen syndrome. Cardiovasc Res. 2001 51(4):670-80. 11530100
Inherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaJLNS Kv7.1 (KCNQ1) properties and channelopathies. J Physiol. 2008 586(7):1785-9. 18174212
Inherited ArrhythmiaJLNS Latent genetic backgrounds and molecular pathogenesis in drug-induced long-QT syndrome. Circ Arrhythm Electrophysiol. 2009 2(5):511-23. 19843919
Inherited ArrhythmiaJLNS Novel mutations in KvLQT1 that affect Iks activation through interactions with Isk. Cardiovasc Res. 2000 45(4):971-80. 10728423
Inherited ArrhythmiaLQTS Mutational spectrum in the cardioauditory syndrome of Jervell and Lange-Nielsen. Hum Genet. 2000 107(5):499-503. 11140949
Inherited ArrhythmiaLQTS Abnormal KCNQ1 trafficking influences disease pathogenesis in hereditary long QT syndromes (LQT1). Cardiovasc Res. 2005 67(3):476-86. 15935335
Inherited ArrhythmiaLQTS Long QT syndrome-associated mutations in the S4-S5 linker of KvLQT1 potassium channels modify gating and interaction with minK subunits. J Biol Chem. 1999 274(30):21063-70. 10409658
Inherited ArrhythmiaLQTS Impaired KCNQ1-KCNE1 and phosphatidylinositol-4,5-bisphosphate interaction underlies the long QT syndrome. Circ Res. 2005 96(7):730-9. 15746441
Inherited ArrhythmiaJLNS A long QT mutation substitutes cholesterol for phosphatidylinositol-4,5-bisphosphate in KCNQ1 channel regulation. PLoS One. 2014 9(3):e93255. doi: 10.1371/journal.pone.0093255. eC 24681627
Inherited ArrhythmiaJLNS Jervell and Lange-Nielsen syndrome: homozygous missense mutation of KCNQ1 in a Turkish family. Pediatr Cardiol. 2013 34(8):2063-7. doi: 10.1007/s00246-013-0634-3. 23400408
Inherited ArrhythmiaJLNS Jervell and Lange-Nielsen syndrome with homozygous missense mutation of the KCNQ1 gene. Turk J Pediatr. 2014 56(5):542-5. 26022593
p.R243Pc.728G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
p.R243Sc.727C>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Mutations in conserved amino acids in the KCNQ1 channel and risk of cardiac events in type-1 long-QT syndrome. J Cardiovasc Electrophysiol. 2009 20(8):859-65. 19490272