Paralogue Annotation for KCNQ1 residue 259

Residue details

Gene: KCNQ1
Reference Sequences: LRG: LRG_287, Ensembl variant: ENST00000155840 / ENSP00000155840
Amino Acid Position: 259
Reference Amino Acid: R - Arginine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNQ1 residue 259

No paralogue variants have been mapped to residue 259 for KCNQ1.



KCNQ1GIRFLQILRMLHVDRQGGTWRLLGSVVFIH>R<QELITTLYIGFLGLIFSSYFVYLAEKDAVN289
KCNQ2SLRFLQILRMIRMDRRGGTWKLLGSVVYAH>S<KELVTAWYIGFLCLILASFLVYLAEKGE--257
KCNQ3SLRFLQILRMLRMDRRGGTWKLLGSAICAH>S<KELITAWYIGFLTLILSSFLVYLVEKDVPE288
KCNQ4SMRFLQILRMVRMDRRGGTWKLLGSVVYAH>S<KELITAWYIGFLVLIFASFLVYLAEKDA--263
KCNQ5SLRFLQILRMVRMDRRGGTWKLLGSVVYAH>S<KELITAWYIGFLVLIFSSFLVYLVEKDA--291
KCNA1VIRLVRVFRIFKLSRHSKGLQILGQTLKAS>M<RELGLLIFFLFIGVILFSSAVYFAEAEE--351
KCNA10IIRLVRVFRIFKLSRHSKGLQILGQTLKAS>M<RELGLLIFFLFIGVILFSSAVYFAEVDE--400
KCNA2VIRLVRVFRIFKLSRHSKGLQILGQTLKAS>M<RELGLLIFFLFIGVILFSSAVYFAEADE--353
KCNA3VIRLVRVFRIFKLSRHSKGLQILGQTLKAS>M<RELGLLIFFLFIGVILFSSAVYFAEADD--423
KCNA4IIRLVRVFRIFKLSRHSKGLQILGHTLRAS>M<RELGLLIFFLFIGVILFSSAVYFAEADE--503
KCNA5VIRLVRVFRIFKLSRHSKGLQILGKTLQAS>M<RELGLLIFFLFIGVILFSSAVYFAEADN--459
KCNA6VIRLVRVFRIFKLSRHSKGLQILGKTLQAS>M<RELGLLIFFLFIGVILFSSAVYFAEADD--401
KCNA7VIRLVRVFRIFKLSRHSKGLQILGQTLRAS>M<RELGLLIFFLFIGVVLFSSAVYFAEVDR--337
KCNB1IFRIMRILRILKLARHSTGLQSLGFTLRRS>Y<NELGLLILFLAMGIMIFSSLVFFAEKDE--356
KCNB2IFRIMRILRILKLARHSTGLQSLGFTLRRS>Y<NELGLLILFLAMGIMIFSSLVFFAEKDE--360
KCNC1VVRFVRILRIFKLTRHFVGLRVLGHTLRAS>T<NEFLLLIIFLALGVLIFATMIYYAERIGAQ372
KCNC2VVRFVRILRIFKLTRHFVGLRVLGHTLRAS>T<NEFLLLIIFLALGVLIFATMIYYAERVGAQ409
KCNC3VVRFVRILRIFKLTRHFVGLRVLGHTLRAS>T<NEFLLLIIFLALGVLIFATMIYYAERIGAD475
KCNC4VVRFVRILRIFKLTRHFVGLRVLGHTLRAS>T<NEFLLLIIFLALGVLIFATMIYYAERIGAR408
KCND1TLRVFRVFRIFKFSRHSQGLRILGYTLKSC>A<SELGFLLFSLTMAIIIFATVMFYAEKGT--351
KCND2TLRVFRVFRIFKFSRHSQGLRILGYTLKSC>A<SELGFLLFSLTMAIIIFATVMFYAEKGS--349
KCND3TLRVFRVFRIFKFSRHSQGLRILGYTLKSC>A<SELGFLLFSLTMAIIIFATVMFYAEKGS--346
KCNF1ALRIMRIARIFKLARHSSGLQTLTYALKRS>F<KELGLLLMYLAVGIFVFSALGYTMEQSH--349
KCNG1VLRALRILYVMRLARHSLGLQTLGLTARRC>T<REFGLLLLFLCVAIALFAPLLYVIENEM--402
KCNG2LLRALRVLYVMRLARHSLGLRSLGLTMRRC>A<REFGLLLLFLCVAMALFAPLVHLAEREL--347
KCNG3VLRMMRIFWVIKLARHFIGLQTLGLTLKRC>Y<REMVMLLVFICVAMAIFSALSQLLEHGL--348
KCNG4VLRALRILYVMRLARHSLGLQTLGLTVRRC>T<REFGLLLLFLAVAITLFSPLVYVAEKES--396
KCNS1VFRLMRIFRVLKLARHSTGLRSLGATLKHS>Y<REVGILLLYLAVGVSVFSGVAYTAEKEE--401
KCNS2VLRLMRIFRILKLARHSTGLRSLGATLKYS>Y<KEVGLLLLYLSVGISIFSVVAYTIEKEE--354
KCNS3ILRLMRIFRILKLARHSVGLRSLGATLRHS>Y<HEVGLLLLFLSVGISIFSVLIYSVEKDD--349
KCNV1VLRLLRALRMLKLGRHSTGLRSLGMTITQC>Y<EEVGLLLLFLSVGISIFSTVEYFAEQSI--371
KCNV2VMRLMRIFRILKLARHSTGLRAFGFTLRQC>Y<QQVGCLLLFIAMGIFTFSAAVYSVEHDV--436
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNQ1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R259Cc.775C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Hypokalemia-induced long QT syndrome with an underlying novel missense mutation in S4-S5 linker of KCNQ1. J Cardiovasc Electrophysiol. 2000 11(9):1048-54. 11021476
Inherited ArrhythmiaLQTS DHPLC analysis of potassium ion channel genes in congenital long QT syndrome. Hum Mutat. 2002 20(5):382-91. 12402336
Inherited ArrhythmiaLQTS The use of genotype-phenotype correlations in mutation analysis for the long QT syndrome. J Med Genet. 2003 40(2):141-5. 12566525
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419
Inherited ArrhythmiaLQTS Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159
p.R259Hc.776G>A Inherited ArrhythmiaLQTS,SQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaSQTS Novel insight into the natural history of short QT syndrome. J Am Coll Cardiol. 2014 63(13):1300-8. doi: 10.1016/j.jacc.2013.09.078. 24291113
Inherited ArrhythmiaSQTS Characterization of a Chinese KCNQ1 mutation (R259H) that shortens repolarization and causes short QT syndrome 2. J Geriatr Cardiol. 2015 12(4):394-401. doi: 10.11909/j.issn.1671-5411.2015 26346102
Inherited ArrhythmiaSQTS Characterization of a Chinese KCNQ1 mutation (R259H) that shortens repolarization and causes short QT syndrome 2. J Geriatr Cardiol. 2015 12(4):394-401. doi: 10.11909/j.issn.1671-5411.2015 26346102
p.R259Lc.776G>T Inherited ArrhythmiaLQTS,JLNSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaJLNS Prevalence and potential genetic determinants of sensorineural deafness in KCNQ1 homozygosity and compound heterozygosity. Circ Cardiovasc Genet. 2013 6(2):193-200. doi: 10.1161/CIRCGENETICS.112.964684 23392653
Inherited ArrhythmiaLQTS RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159