Paralogue Annotation for KCNQ1 residue 341

Residue details

Gene: KCNQ1
Reference Sequences: LRG: LRG_287, Ensembl variant: ENST00000155840 / ENSP00000155840
Amino Acid Position: 341
Reference Amino Acid: A - Alanine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNQ1 residue 341

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNQ2A306TEpilepsy, benign neonatalHigh9 9425895, 19453707, 26138355
KCNQ2A306VSudden unexpected death in epilepsyHigh9 26704558

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNQ1.



KCNQ1TTIGYGDKVPQTWVGKTIASCFSVFAISFF>A<LPAGILGSGFALKVQQKQRQKHFNRQIPA-370
KCNQ2TTIGYGDKYPQTWNGRLLAATFTLIGVSFF>A<LPAGILGSGFALKVQEQHRQKHFEKRRNP-335
KCNQ3ATIGYGDKTPKTWEGRLIAATFSLIGVSFF>A<LPAGILGSGLALKVQEQHRQKHFEKRRKP-374
KCNQ4TTIGYGDKTPHTWLGRVLAAGFALLGISFF>A<LPAGILGSGFALKVQEQHRQKHFEKRRMP-341
KCNQ5TTIGYGDKTPLTWLGRLLSAGFALLGISFF>A<LPAGILGSGFALKVQEQHRQKHFEKRRNP-369
KCNA1TTVGYGDMYPVTIGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETEGEEQAQLLH--429
KCNA10TTVGYGDMCPTTPGGKIVGTLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETENEEKQNIPGEI480
KCNA2TTVGYGDMVPTTIGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETEGEEQAQYLQ--431
KCNA3TTVGYGDMHPVTIGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETEGEEQSQYMH--501
KCNA4TTVGYGDMKPITVGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETENEEQTQLTQ--581
KCNA5TTVGYGDMRPITVGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETDHEEPAVLKEE-538
KCNA6TTVGYGDMYPMTVGGKIVGSLCAIAGVLTI>A<LPVPVIVSNFNYFYHRETEQEEQGQYTHV-480
KCNA7TTVGYGDMAPVTVGGKIVGSLCAIAGVLTI>S<LPVPVIVSNFSYFYHRETEGEEAGMFSHV-416
KCNB1TTVGYGDIYPKTLLGKIVGGLCCIAGVLVI>A<LPIPIIVNNFSEFYKEQKRQEKAIKRREA-435
KCNB2TTVGYGDIYPKTLLGKIVGGLCCIAGVLVI>A<LPIPIIVNNFSEFYKEQKRQEKAIKRREA-439
KCNC1TTLGYGDMYPQTWSGMLVGALCALAGVLTI>A<MPVPVIVNNFGMYYSLAMAKQKLPKKKKK-458
KCNC2TTLGYGDMYPQTWSGMLVGALCALAGVLTI>A<MPVPVIVNNFGMYYSLAMAKQKLPRKRKK-495
KCNC3TTLGYGDMYPKTWSGMLVGALCALAGVLTI>A<MPVPVIVNNFGMYYSLAMAKQKLPKKKNK-561
KCNC4TTLGYGDMYPKTWSGMLVGALCALAGVLTI>A<MPVPVIVNNFGMYYSLAMAKQKLPKKRKK-494
KCND1TTLGYGDMVPSTIAGKIFGSICSLSGVLVI>A<LPVPVIVSNFSRIYHQNQRADKRRAQQKV-430
KCND2TTLGYGDMVPKTIAGKIFGSICSLSGVLVI>A<LPVPVIVSNFSRIYHQNQRADKRRAQKKA-428
KCND3TTLGYGDMVPKTIAGKIFGSICSLSGVLVI>A<LPVPVIVSNFSRIYHQNQRADKRRAQKKA-425
KCNF1TTVGYGDIYPKTTLGKLNAAISFLCGVIAI>A<LPIHPIINNFVRYYNKQRVLETAAKHELE-428
KCNG1TTVGYGDMVPRSTPGQVVALSSILSGILLM>A<FPVTSIFHTFSRSYLELKQEQERVMFRRA-482
KCNG2TTVGYGDMVPRSLPGQVVALSSILSGILLM>A<FPVTSIFHTFSRSYSELKEQQQRAASPEP-427
KCNG3TTVGYGDMYPITVPGRILGGVCVVSGIVLL>A<LPITFIYHSFVQCYHELKFRSARYSR----428
KCNG4TTVGYGDMVPRSVPGQMVALSSILSGILIM>A<FPATSIFHTFSHSYLELKKEQEQLQARLR-476
KCNS1TTVGYGDVVPVTVAGKLAASGCILGGILVV>A<LPITIIFNKFSHFYRRQKALEAAVRNSNH-479
KCNS2TTVGYGDVVPGTTAGKLTASACILAGILVV>V<LPITLIFNKFSHFYRRQKQLESAMRSCDF-432
KCNS3TTVGYGDTHPVTLAGKLIASTCIICGILVV>A<LPITIIFNKFSKYYQKQKDIDVDQCSEDA-428
KCNV1TTVGYGDIRPDTTTGKIVAFMCILSGILVL>A<LPIAIINDRFSACYFTLKLKEAAVRQREA-450
KCNV2STVGYGDMYPETHLGRFFAFLCIAFGIILN>G<MPISILYNKFSDYYSKLKAYEYTTIRRER-515
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNQ1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A341Ec.1022C>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Positional cloning of a novel potassium channel gene: KVLQT1 mutations cause cardiac arrhythmias. Nat Genet. 1996 12(1):17-23. 8528244
Inherited ArrhythmiaLQTS C-terminal HERG mutations: the role of hypokalemia and a KCNQ1-associated mutation in cardiac event occurrence. Circulation. 1999 99(11):1464-70. 10086971
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS KCNQ1 mutations in patients with a family history of lethal cardiac arrhythmias and sudden death. Clin Genet. 2003 63(4):273-82. 12702160
Inherited ArrhythmiaLQTS Location of mutation in the KCNQ1 and phenotypic presentation of long QT syndrome. J Cardiovasc Electrophysiol. 2003 14(11):1149-53. 14678125
Inherited ArrhythmiaLQTS The common long-QT syndrome mutation KCNQ1/A341V causes unusually severe clinical manifestations in patients with different ethnic backgrounds: toward a mutation-specific risk stratification. Circulation. 2007 116(21):2366-75. 17984373
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Arrhythmia in heart and brain: KCNQ1 mutations link epilepsy and sudden unexplained death. Sci Transl Med. 2009 1(2):2ra6. 20368164
Inherited ArrhythmiaLQTS Functional effects of mutations in KvLQT1 that cause long QT syndrome. J Cardiovasc Electrophysiol. 1999 10(6):817-26. 10376919
Inherited ArrhythmiaLQTS Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
p.A341Gc.1022C>G Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
p.A341Vc.1022C>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Positional cloning of a novel potassium channel gene: KVLQT1 mutations cause cardiac arrhythmias. Nat Genet. 1996 12(1):17-23. 8528244
Inherited ArrhythmiaLQTS Evidence of a long QT founder gene with varying phenotypic expression in South African families. J Med Genet. 1996 33(7):567-73. 8818942
Inherited ArrhythmiaLQTS KVLQT1 mutations in three families with familial or sporadic long QT syndrome. Hum Mol Genet. 1996 5(9):1319-24. 8872472
Inherited ArrhythmiaLQTS KVLQT1 C-terminal missense mutation causes a forme fruste long-QT syndrome. Circulation. 1997 96(9):2778-81. 9386136
Inherited ArrhythmiaLQTS New mutations in the KVLQT1 potassium channel that cause long-QT syndrome. Circulation. 1998 97(13):1264-9. 9570196
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS DHPLC analysis of potassium ion channel genes in congenital long QT syndrome. Hum Mutat. 2002 20(5):382-91. 12402336
Inherited ArrhythmiaLQTS Location of mutation in the KCNQ1 and phenotypic presentation of long QT syndrome. J Cardiovasc Electrophysiol. 2003 14(11):1149-53. 14678125
Inherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Denaturing high-performance liquid chromatography screening of the long QT syndrome-related cardiac sodium and potassium channel genes and identification of novel mutations and single nucleotide polymorphisms. J Hum Genet. 2005 50(9):490-6. 16155735
Inherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Identification and functional characterization of KCNQ1 mutations around the exon 7-intron 7 junction affecting the splicing process. Biochim Biophys Acta. 2011 1812(11):1452-9. 21810471
Inherited ArrhythmiaLQTS Functional effects of mutations in KvLQT1 that cause long QT syndrome. J Cardiovasc Electrophysiol. 1999 10(6):817-26. 10376919
Inherited ArrhythmiaLQTS Partial restoration of the long QT syndrome associated KCNQ1 A341V mutant by the KCNE1 β-subunit. Biochim Biophys Acta. 2011 1810(12):1285-93. 21854832
Inherited ArrhythmiaLQTS Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419
Inherited ArrhythmiaLQTS Phenotypic variability and unusual clinical severity of congenital long-QT syndrome in a founder population. Circulation. 2005 112(17):2602-10. 16246960
Inherited ArrhythmiaLQTS Neural control of heart rate is an arrhythmia risk modifier in long QT syndrome. J Am Coll Cardiol. 2008 51(9):920-9. 18308161
Inherited ArrhythmiaLQTS Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695
Inherited ArrhythmiaLQTS Dominant-negative control of cAMP-dependent IKs upregulation in human long-QT syndrome type 1. Circ Res. 2012 110(2):211-9. 22095730
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS The common long-QT syndrome mutation KCNQ1/A341V causes unusually severe clinical manifestations in patients with different ethnic backgrounds: toward a mutation-specific risk stratification. Circulation. 2007 116(21):2366-75. 17984373
Inherited ArrhythmiaLQTS Multiscale complexity analysis of the cardiac control identifies asymptomatic and symptomatic patients in long QT syndrome type 1. PLoS One. 2014 9(4):e93808. doi: 10.1371/journal.pone.0093808. eC 24705789
Inherited ArrhythmiaLQTS Cellular mechanisms underlying the increased disease severity seen for patients with long QT syndrome caused by compound mutations in KCNQ1. Biochem J. 2014 462(1):133-42. doi: 10.1042/BJ20140425. 24912595
Inherited ArrhythmiaLQTS Autonomic control of heart rate and QT interval variability influences arrhythmic risk in long QT syndrome type 1. J Am Coll Cardiol. 2015 65(4):367-74. doi: 10.1016/j.jacc.2014.11.015. 25634836