No paralogue variants have been mapped to residue 568 for KCNQ1.
KCNQ1 | VRDVIEQYSQGHLNLMVRIKELQRRLDQSI>G<KPSLFIS-----------V----------- | 576 |
KCNQ2 | VMDVIEQYSAGHLDMLSRIKSLQSRVDQIV>G<RGPAITD--KDR--T--KG----------- | 607 |
KCNQ3 | VKDVIEQYSAGHLDMLSRIKYLQTRIDMIF>T<PGPPSTP--KHKKSQKGSAFTFPSQQSPRN | 601 |
KCNQ4 | VKDVIEQYSAGHLDMLGRIKSLQTRVDQIV>G<RGPGDRKAREKG--D--KG----------- | 603 |
KCNQ5 | VKDVIEQYSAGHLDMLCRIKSLQTRVDQIL>G<KGQITSD-KKSR--E--KI----------- | 590 |
KCNA1 | ------------------------------>-<------------------------------ | |
KCNA10 | ------------------------------>-<------------------------------ | |
KCNA2 | ------------------------------>-<------------------------------ | |
KCNA3 | ------------------------------>-<------------------------------ | |
KCNA4 | ------------------------------>-<------------------------------ | |
KCNA5 | ------------------------------>-<------------------------------ | |
KCNA6 | ------------------------------>-<------------------------------ | |
KCNA7 | ------------------------------>-<------------------------------ | |
KCNB1 | VLGMYHDPLRNRGSAAAAVAGLECA----->-<------------------------------ | 711 |
KCNB2 | LPVTTADFSLTTPQHISTILLEETP----->-<------------------------------ | 761 |
KCNC1 | ----------DLCKESP---VIAKY----->-<------------------------------ | 576 |
KCNC2 | G----YEKSRSLNNIAGLAGNALRL----->-<------------------------------ | 614 |
KCNC3 | ATGAPPLPPQDWRKPGPPS-FLPDL----->-<------------------------------ | 747 |
KCNC4 | G----TFVLRDLPLQHSP---EAAC----->-<------------------------------ | 624 |
KCND1 | SRSSLNAKPHDSLDLNCDSRDFVAA----->-<------------------------------ | 597 |
KCND2 | SRSSLNAKMEECVKLNCEQPYVTTA----->-<------------------------------ | 596 |
KCND3 | SRSSLNLKADDGLRPNCKTSQITTA----->-<------------------------------ | 613 |
KCNF1 | ------------------------------>-<------------------------------ | |
KCNG1 | ------------------------------>-<------------------------------ | |
KCNG2 | ------------------------------>-<------------------------------ | |
KCNG3 | ------------------------------>-<------------------------------ | |
KCNG4 | ------------------------------>-<------------------------------ | |
KCNS1 | ------------------------------>-<------------------------------ | |
KCNS2 | ------------------------------>-<------------------------------ | |
KCNS3 | ------------------------------>-<------------------------------ | |
KCNV1 | ------------------------------>-<------------------------------ | |
KCNV2 | ------------------------------>-<------------------------------ | |
cons | > < |
Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
---|---|---|---|---|---|
p.G568A | c.1703G>C | Inherited Arrhythmia | LQTS | rs199472806 | SIFT: deleterious Polyphen: probably damaging |
Reports | Inherited Arrhythmia | LQTS | KCNQ1 mutations in patients with a family history of lethal cardiac arrhythmias and sudden death. Clin Genet. 2003 63(4):273-82. 12702160 | ||
Inherited Arrhythmia | LQTS | RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159 | |||
p.G568R | c.1702G>A | Inherited Arrhythmia | LQTS,JLNS | rs199472807 | SIFT: deleterious Polyphen: probably damaging |
Reports | Inherited Arrhythmia | LQTS | Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476 | ||
Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | |||
Inherited Arrhythmia | LQTS | Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300 | |||
Inherited Arrhythmia | LQTS | Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429 | |||
Inherited Arrhythmia | JLNS | Prevalence and potential genetic determinants of sensorineural deafness in KCNQ1 homozygosity and compound heterozygosity. Circ Cardiovasc Genet. 2013 6(2):193-200. doi: 10.1161/CIRCGENETICS.112.964684 23392653 | |||
Inherited Arrhythmia | LQTS | RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159 | |||
p.G568E | c.1703G>A | Inherited Arrhythmia | LQTS | SIFT: Polyphen: | |
Reports | Inherited Arrhythmia | LQTS | Compound Mutations Cause Increased Cardiac Events in Children with Long QT Syndrome: Can the Sequence Homology-Based Tools be Applied for Prediction of Phenotypic Severity? Pediatr Cardiol. 2016 37(5):962-70. doi: 10.1007/s00246-016-1378-7. 27041096 |